Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCF1 Peptide - C-terminal region

NCF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NCF1A, NOXO2, p47phox, SH3PXD1A

UniProt

P14598

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000256.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Omeprazole Sodium Salt
TRC-O635013-250MG 250 mg

Omeprazole Sodium Salt

Sign In for Pricing
View Details
Vti1a Mouse Gene Knockout Kit (CRISPR)
KN519290 1 Kit

Vti1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710059 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Myometrium
CS800143 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
5Alpha-androstane-3Alpha,17Beta-diol-17-glucuronide-16,16,17-D3 (D3-3Alpha-diol-17G)
TRC-A294421-10MG 10 mg

5Alpha-androstane-3Alpha,17Beta-diol-17-glucuronide-16,16,17-D3 (D3-3Alpha-diol-17G)

Sign In for Pricing
View Details
WNT3 Human Gene Knockout Kit (CRISPR)
KN211115RB 1 Kit

WNT3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details