Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCF1 Peptide - C-terminal region

NCF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NCF1A, NOXO2, p47phox, SH3PXD1A

UniProt

P14598

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000256.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFLQQRRRQARPGPQSPGSPLEEERQTQRSKPQPAVPPRPSADLILNRCS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBL1 (Ab-369) Antibody
8B0812-AAT 50 µg

RBL1 (Ab-369) Antibody

Sign In for Pricing
View Details
Beta-Nicotinamide Mononucleotide
TRC-N407765-10MG 10 mg

Beta-Nicotinamide Mononucleotide

Sign In for Pricing
View Details
Transfer Pipettes
P4133-11 500 Units/Case

Transfer Pipettes

Sign In for Pricing
View Details
PLAC8 Human Gene Knockout Kit (CRISPR)
KN212588RB 1 Kit

PLAC8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HNF4α/γ Antibody
8C10596-AAT 50 µg

HNF4α/γ Antibody

Sign In for Pricing
View Details
Loratadine Impurity 5 Hydrochloride
TRC-L491140-5MG 5 mg

Loratadine Impurity 5 Hydrochloride

Sign In for Pricing
View Details