Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPB41L3 Peptide - N-terminal region

EPB41L3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

4.1B, DAL1, DAL-1

UniProt

Q9Y2J2

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001268462.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STOML2 Protein Vector (Human) (pPM-C-His)
PV040632 500 ng

STOML2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Anti-ADSS Antibody
CQA8064-01 30 µL

Anti-ADSS Antibody

Sign In for Pricing
View Details
Anti-ADSS Antibody
CQA8064-02 50 μL

Anti-ADSS Antibody

Sign In for Pricing
View Details
Anti-ADSS Antibody
CQA8064-03 100 µL

Anti-ADSS Antibody

Sign In for Pricing
View Details
Anti-ADSS Antibody
CQA8064-04 200 µL

Anti-ADSS Antibody

Sign In for Pricing
View Details
GPA33 Rabbit Monoclonal Antibody
AG4550 50 µL

GPA33 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details