EPB41L3 Peptide - N-terminal region
EPB41L3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
4.1B, DAL1, DAL-1
UniProt
Q9Y2J2
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001268462.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TTESGSDSESKPDQEAEPQEAAGAQGRAGAPVPEPPKEEQQQALEQFAAA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1197899-01 0.02 mg (E-Coli)
Recombinant Neisseria meningitidis serogroup A / serotype 4A Putative shikimate kinase (aroK)
Sign In for Pricing
View Details MBS1197899-02 0.1 mg (E-Coli)
Recombinant Neisseria meningitidis serogroup A / serotype 4A Putative shikimate kinase (aroK)
Sign In for Pricing
View Details MBS1197899-03 0.02 mg (Yeast)
Recombinant Neisseria meningitidis serogroup A / serotype 4A Putative shikimate kinase (aroK)
Sign In for Pricing
View Details MBS1197899-04 0.1 mg (Yeast)
Recombinant Neisseria meningitidis serogroup A / serotype 4A Putative shikimate kinase (aroK)
Sign In for Pricing
View Details MBS1197899-05 0.02 mg (Baculovirus)
Recombinant Neisseria meningitidis serogroup A / serotype 4A Putative shikimate kinase (aroK)
Sign In for Pricing
View Details