Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLL1 Peptide - middle region

TLL1 Peptide - middle region

Product Specifications

Product Name Alternative

TLL, ASD6

UniProt

O43897

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191689.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Liver
CS641367 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Biotin,  30nm
GAB-02-30 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Biotin, 30nm

Sign In for Pricing
View Details
Recombinant Mouse TrkC/NTRK3 Protein (His Tag)
PKSM040737 100 µg

Recombinant Mouse TrkC/NTRK3 Protein (His Tag)

Sign In for Pricing
View Details
DTYMK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C4]
TA503496AM 100 µL

DTYMK Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C4]

Sign In for Pricing
View Details
(4R,6R)-Actinol
TRC-A192015-250MG 250 mg

(4R,6R)-Actinol

Sign In for Pricing
View Details
LRRC52 (NM_001005214) Human Over-expression Lysate
LY423806 100 µg

LRRC52 (NM_001005214) Human Over-expression Lysate

Sign In for Pricing
View Details