Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TLL1 Peptide - middle region

TLL1 Peptide - middle region

Product Specifications

Product Name Alternative

TLL, ASD6

UniProt

O43897

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191689.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL11 Antibody (Biotin)
KB-1846-01 50 μL

CXCL11 Antibody (Biotin)

Sign In for Pricing
View Details
CXCL11 Antibody (Biotin)
KB-1846-02 100 µL

CXCL11 Antibody (Biotin)

Sign In for Pricing
View Details
CXCL11 Antibody (Biotin)
KB-1846-03 1 mL

CXCL11 Antibody (Biotin)

Sign In for Pricing
View Details
Pspc1 Mouse Gene Knockout Kit (CRISPR)
KN514139 1 Kit

Pspc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF640R conjugate, 0.1mg/mL
BNC402558-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIGHM/2558), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CINP (NM_032630) Human Over-expression Lysate
LC403179 20 µg

CINP (NM_032630) Human Over-expression Lysate

Sign In for Pricing
View Details