Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PALLD Peptide - middle region

PALLD Peptide - middle region

Product Specifications

Product Name Alternative

MYN, PNCA1, CGI151, SIH002, CGI-151

UniProt

Q8WX93

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159580.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OMP CRISPR Activation Plasmid (m)
sc-422061-ACT 20 µg

OMP CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
PPAPDC3 antibody
70R-19435 50 μL

PPAPDC3 antibody

Sign In for Pricing
View Details
CD99L2 3'UTR GFP Stable Cell Line
TU053923 1.0 mL

CD99L2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rat D-Amino Acid Oxidase ELISA Kit
MBS107581-01 48 Well

Rat D-Amino Acid Oxidase ELISA Kit

Sign In for Pricing
View Details
Rat D-Amino Acid Oxidase ELISA Kit
MBS107581-02 96 Well

Rat D-Amino Acid Oxidase ELISA Kit

Sign In for Pricing
View Details
Rat D-Amino Acid Oxidase ELISA Kit
MBS107581-03 5x 96 Well

Rat D-Amino Acid Oxidase ELISA Kit

Sign In for Pricing
View Details