Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PALLD Peptide - middle region

PALLD Peptide - middle region

Product Specifications

Product Name Alternative

MYN, PNCA1, CGI151, SIH002, CGI-151

UniProt

Q8WX93

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001159580.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LCN2 Antibody
orb253529 100 µL

LCN2 Antibody

Sign In for Pricing
View Details
Rabbit anti-DAXX Antibody
MBS4506986-01 0.05 mL

Rabbit anti-DAXX Antibody

Sign In for Pricing
View Details
Rabbit anti-DAXX Antibody
MBS4506986-02 0.1 mL

Rabbit anti-DAXX Antibody

Sign In for Pricing
View Details
Rabbit anti-DAXX Antibody
MBS4506986-03 5x 0.1 mL

Rabbit anti-DAXX Antibody

Sign In for Pricing
View Details
NXT1 Protein Vector (Mouse) (pPB-C-His)
PV207462 500 ng

NXT1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
HCC1806
C0006043 One Frozen Vial

HCC1806

Sign In for Pricing
View Details