Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1CB Peptide - C-terminal region

PPP1CB Peptide - C-terminal region

Product Specifications

Product Name Alternative

PP1B, PP-1B, PPP1CD, PP1beta, HEL-S-80p

UniProt

P62140

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002700.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reg3 gamma Recombinant Protein
91-855 0.05 mg

Reg3 gamma Recombinant Protein

Sign In for Pricing
View Details
Kinesin Light Chain 4 (KLC4) Antibody (FITC)
abx304295-01 20 µg

Kinesin Light Chain 4 (KLC4) Antibody (FITC)

Sign In for Pricing
View Details
Kinesin Light Chain 4 (KLC4) Antibody (FITC)
abx304295-02 50 µg

Kinesin Light Chain 4 (KLC4) Antibody (FITC)

Sign In for Pricing
View Details
Kinesin Light Chain 4 (KLC4) Antibody (FITC)
abx304295-03 100 µg

Kinesin Light Chain 4 (KLC4) Antibody (FITC)

Sign In for Pricing
View Details
Kinesin Light Chain 4 (KLC4) Antibody (FITC)
abx304295-04 200 µg

Kinesin Light Chain 4 (KLC4) Antibody (FITC)

Sign In for Pricing
View Details
Kinesin Light Chain 4 (KLC4) Antibody (FITC)
abx304295-05 1 mg

Kinesin Light Chain 4 (KLC4) Antibody (FITC)

Sign In for Pricing
View Details