Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPP1CB Peptide - C-terminal region

PPP1CB Peptide - C-terminal region

Product Specifications

Product Name Alternative

PP1B, PP-1B, PPP1CD, PP1beta, HEL-S-80p

UniProt

P62140

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002700.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABHD14B Conjugated Antibody
orb1616955 100 µL

ABHD14B Conjugated Antibody

Sign In for Pricing
View Details
Anserini GLUT4 ELISA Kit
EAG0208 96 Tests

Anserini GLUT4 ELISA Kit

Sign In for Pricing
View Details
WRS22
HY-178101 1 Each

WRS22

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Rabbit Polyclonal Antibody
TA324687 400 µL

Cyclin D1 (CCND1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
K-756
BA4372-5.1 1 mL (10 mM in DMSO)

K-756

Sign In for Pricing
View Details
Mouse Collagen alpha-1 (XVIII) chain (COL18A1/ES) ELISA kit
CSB-E07974m-01 48 Tests

Mouse Collagen alpha-1 (XVIII) chain (COL18A1/ES) ELISA kit

Sign In for Pricing
View Details