Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BET1 Peptide - middle region

BET1 Peptide - middle region

Product Specifications

Product Name Alternative

HBET1

UniProt

O15155

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005859.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-DRB4 (NM_021983) Human Over-expression Lysate
LC402894 20 µg

HLA-DRB4 (NM_021983) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS701137 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Mouse Chromodomain Helicase DNA Binding Protein 4 (CHD4) ELISA Kit
RDR-CHD4-Mu-01 96 Tests

Mouse Chromodomain Helicase DNA Binding Protein 4 (CHD4) ELISA Kit

Sign In for Pricing
View Details
Mouse Chromodomain Helicase DNA Binding Protein 4 (CHD4) ELISA Kit
RDR-CHD4-Mu-02 48 Tests

Mouse Chromodomain Helicase DNA Binding Protein 4 (CHD4) ELISA Kit

Sign In for Pricing
View Details
Human Lambda Light Chain (B-Cell Marker) (LLC/3778R), CF568 conjugate, 0.1mg/mL
BNC683778-500 1x 500 µL

Human Lambda Light Chain (B-Cell Marker) (LLC/3778R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD2 Antibody[RM2-5]
E-AB-F1387Q-01 50 Tests

Elab Fluor® Violet 450 Anti-Mouse CD2 Antibody[RM2-5]

Sign In for Pricing
View Details