Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BET1 Peptide - middle region

BET1 Peptide - middle region

Product Specifications

Product Name Alternative

HBET1

UniProt

O15155

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005859.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1a (C1A/711), CF568 conjugate, 0.1mg/mL
BNC680711-500 1x 500 µL

CD1a (C1A/711), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Polystyrene A REM
HA110018.25G 25 g

Polystyrene A REM

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS801296 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
LIMS1 Polyclonal Antibody
E-AB-11365-01 20 µL

LIMS1 Polyclonal Antibody

Sign In for Pricing
View Details
LIMS1 Polyclonal Antibody
E-AB-11365-02 60 µL

LIMS1 Polyclonal Antibody

Sign In for Pricing
View Details
LIMS1 Polyclonal Antibody
E-AB-11365-03 120 µL

LIMS1 Polyclonal Antibody

Sign In for Pricing
View Details