Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBG1 Peptide - middle region

TUBG1 Peptide - middle region

Product Specifications

Product Name Alternative

TUBG, GCP-1, CDCBM4, TUBGCP1

UniProt

P23258

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001061.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-500 1x 500 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL
BNC881050-100 1x 100 µL

CD3e (CRIS-7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), CF568 conjugate, 0.1mg/mL
BNC681237-100 1x 100 µL

P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF568 conjugate, 0.1mg/mL
BNC680900-500 1x 500 µL

Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3) (CSF3/900), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details