Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOSIP Peptide - middle region

NOSIP Peptide - middle region

Product Specifications

Product Name Alternative

CGI-25

UniProt

Q9Y314

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257889.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PTPIP51/RMDN3 Antibody Picoband®, HRP Conjugate
A09297-HRP 100 µg/Vial

Anti-PTPIP51/RMDN3 Antibody Picoband®, HRP Conjugate

Sign In for Pricing
View Details
Goat Anti-CENTB1 / ACAP1 Antibody
OAEB01830-100UG 100 µg

Goat Anti-CENTB1 / ACAP1 Antibody

Sign In for Pricing
View Details
FAIM3 Protein Vector (Human) (pPB-N-His)
PV014934 500 ng

FAIM3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
ArpT1 antibody
20R-2661 100 uL

ArpT1 antibody

Sign In for Pricing
View Details
FAM32C Recombinant Protein (Human)
RP057999 100 µg

FAM32C Recombinant Protein (Human)

Sign In for Pricing
View Details
SEMA3C Antibody (FITC)
orb516135-01 50 µg

SEMA3C Antibody (FITC)

Sign In for Pricing
View Details