What is the catalog number for NOSIP Peptide - middle region?

The catalog number for NOSIP Peptide - middle region is orb1998743.

What sizes are available for NOSIP Peptide - middle region?

NOSIP Peptide - middle region is available in the following size(s): 100 µg.

Is NOSIP Peptide - middle region in stock?

NOSIP Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

NOSIP Peptide - middle region

Product Specifications

Product Name Alternative

CGI-25

UniProt

Q9Y314

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001257889.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGTRREEQKELQRAASQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TA502351S 30 µL

CHCHD5 Mouse Monoclonal Antibody [Clone ID: OTI1A12]

Sign In for Pricing

View Details

MBS098928 Inquire

Goat Semaphorin 5A ELISA Kit

Sign In for Pricing

View Details

22565011 1.0 µg DNA

GPR4 ORF Vector (Human) (pORF)

Sign In for Pricing

View Details

MBS7058425 Inquire

Recombinant Escherichia coli O157:H7 Spermidine export protein MdtI (mdtI), partial

Sign In for Pricing

View Details

462952 5.0mg

ML-133 (hydrochloride)

Sign In for Pricing

View Details

TU218784 1.0 mL

RGD1563551 3'UTR Luciferase Stable Cell Line

Sign In for Pricing

View Details