Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS4X Peptide - C-terminal region

RPS4X Peptide - C-terminal region

Product Specifications

Product Name Alternative

S4, CCG2, RPS4, SCAR, SCR10, DXS306

UniProt

P62701

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000998.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Kidney
CR560170 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
EMR3 Antibody
8G092-AAT 50 µg

EMR3 Antibody

Sign In for Pricing
View Details
Human EDDM13 activation kit by CRISPRa
GA119298 1 Kit

Human EDDM13 activation kit by CRISPRa

Sign In for Pricing
View Details
Human fast skeletal Myosin (MYLPF) activation kit by CRISPRa
GA109296 1 Kit

Human fast skeletal Myosin (MYLPF) activation kit by CRISPRa

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant CGA/hCG alpha Monoclonal Antibody
AN301968L-01 50 µL

Recombinant CGA/hCG alpha Monoclonal Antibody

Sign In for Pricing
View Details