Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS4X Peptide - C-terminal region

RPS4X Peptide - C-terminal region

Product Specifications

Product Name Alternative

S4, CCG2, RPS4, SCAR, SCR10, DXS306

UniProt

P62701

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000998.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ypel2 (NM_001005341) Mouse Tagged ORF Clone
MG200556 10 µg

Ypel2 (NM_001005341) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rfc5 Mouse Gene Knockout Kit (CRISPR)
KN514692 1 Kit

Rfc5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SRRM3 (NM_001110199) Human Over-expression Lysate
LC426313 20 µg

SRRM3 (NM_001110199) Human Over-expression Lysate

Sign In for Pricing
View Details
PYK2 (PTK2B) Rabbit Polyclonal Antibody
AP02719PU-S 50 µL

PYK2 (PTK2B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADAMTSL3 (NM_207517) Human Over-expression Lysate
LC403917 20 µg

ADAMTSL3 (NM_207517) Human Over-expression Lysate

Sign In for Pricing
View Details
RUNX1+RUNX2+RUNX3 Recombinant Rabbit Monoclonal Antibody [SD0803]
ET1612-49 100 µL

RUNX1+RUNX2+RUNX3 Recombinant Rabbit Monoclonal Antibody [SD0803]

Sign In for Pricing
View Details