Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESYT1 Peptide - middle region

ESYT1 Peptide - middle region

Product Specifications

Product Name Alternative

MBC2, FAM62A

UniProt

Q9BSJ8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171725.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLDRAQDLPLKKGNKEPNPMVQLSIQDVTQESKAVYSTNCPVWEEAFRFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taxine (mixture of Taxine B and iso-Taxine B) (~80%)
TRC-T100085-10MG 10 mg

Taxine (mixture of Taxine B and iso-Taxine B) (~80%)

Sign In for Pricing
View Details
GOLGA2L1 (C-term) Rabbit Polyclonal Antibody
AP51889PU-N 400 µL

GOLGA2L1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HRP Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-
H-6601-1 1 mg

HRP Conjugated Cicer arietinum Lectin (Chick Pea) -CPA-

Sign In for Pricing
View Details
Calbryte™ 520 AM
20651-AAT 10x 50 µg

Calbryte™ 520 AM

Sign In for Pricing
View Details
TXN Polyclonal Antibody
E-AB-62251-01 60 µL

TXN Polyclonal Antibody

Sign In for Pricing
View Details
TXN Polyclonal Antibody
E-AB-62251-02 120 µL

TXN Polyclonal Antibody

Sign In for Pricing
View Details