Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ESYT1 Peptide - middle region

ESYT1 Peptide - middle region

Product Specifications

Product Name Alternative

MBC2, FAM62A

UniProt

Q9BSJ8

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171725.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YLDRAQDLPLKKGNKEPNPMVQLSIQDVTQESKAVYSTNCPVWEEAFRFF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NM23 Mouse Monoclonal Antibody [13C2]
EM1901-18 100 µL

NM23 Mouse Monoclonal Antibody [13C2]

Sign In for Pricing
View Details
MYL9 Recombinant Rabbit Monoclonal Antibody [JE34-63]
HA721361 100 µL

MYL9 Recombinant Rabbit Monoclonal Antibody [JE34-63]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: right
CB500860 1 Block

Frozen Tissue Blocks, Ovary: right

Sign In for Pricing
View Details
C5ar1 Mouse Gene Knockout Kit (CRISPR)
KN302383LP 1 Kit

C5ar1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CHMP5 (NM_001195536) Human Over-expression Lysate
LY434012 100 µg

CHMP5 (NM_001195536) Human Over-expression Lysate

Sign In for Pricing
View Details
ZFluor™ 633 succinimidyl ester
1510-AAT 1 mg

ZFluor™ 633 succinimidyl ester

Sign In for Pricing
View Details