What is the catalog number for PAK1 Peptide - middle region?

The catalog number for PAK1 Peptide - middle region is orb1998665.

What sizes are available for PAK1 Peptide - middle region?

PAK1 Peptide - middle region is available in the following size(s): 100 µg.

Is PAK1 Peptide - middle region in stock?

PAK1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

PAK1 Peptide - middle region

Product Specifications

Product Name Alternative

PAKalpha

UniProt

Q13153

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001122092.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAP60607-100UG 100 µg

SPSB2 Peptide - N-terminal region (AAP60607)

Sign In for Pricing

View Details

LV700316 1.0 µg DNA

DCX Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing

View Details

sc-40110-PR 10 µM - 20 µL

MC2-R (m) -PR

Sign In for Pricing

View Details

18779171 3x 5 nmol

DYRK4 siRNA Oligos set (Human)

Sign In for Pricing

View Details

A04372-2-Fluoro647 100 µg/Vial

Anti-FACL4/ACSL4 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing

View Details

orb1447528 500 µg

FUCA1 Antibody Blocking peptide

Sign In for Pricing

View Details