PAK1 Peptide - middle region
PAK1 Peptide - middle region
Product Specifications
Product Name Alternative
PAKalpha
UniProt
Q13153
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001122092.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7144456 Inquire
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ERD7 Polyclonal Antibody
Sign In for Pricing
View Details 
MBS7184204 Inquire
Rabbit anti-Escherichia coli (strain 8739/DSM 1576/Crooks) PYRB Polyclonal Antibody
Sign In for Pricing
View Details FY-AB41331-01 1 mL
Biotin-Linked Anti-Fibrous Sheath Interacting Protein 1 (FSIP1)
Sign In for Pricing
View Details FY-AB41331-02 100 µL
Biotin-Linked Anti-Fibrous Sheath Interacting Protein 1 (FSIP1)
Sign In for Pricing
View Details FY-AB41331-03 200 µL
Biotin-Linked Anti-Fibrous Sheath Interacting Protein 1 (FSIP1)
Sign In for Pricing
View Details