What is the catalog number for MCM6 Peptide - C-terminal region?

The catalog number for MCM6 Peptide - C-terminal region is orb1998654.

What sizes are available for MCM6 Peptide - C-terminal region?

MCM6 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is MCM6 Peptide - C-terminal region in stock?

MCM6 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MCM6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

Mis5, P105MCM, MCG40308

UniProt

Q14566

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_005906.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PV161400 500 ng

CAPN3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing

View Details

E55A01971 100 µg

BLOC1S6 Polyclonal Antibody

Sign In for Pricing

View Details

I8600-05-ML650 100 µL

IRAK (IL-1 Receptor-associated Kinase) (MaxLight 650) discontinued

Sign In for Pricing

View Details

orb2712709-01 50 µL

PLA2G3 Rabbit pAb

Sign In for Pricing

View Details

orb2712709-02 100 µL

PLA2G3 Rabbit pAb

Sign In for Pricing

View Details

GWB-556486 0.05 mL

Anti- Metabotropic glutamate receptor 3 Antibody

Sign In for Pricing

View Details