MCM6 Peptide - C-terminal region
MCM6 Peptide - C-terminal region
Product Specifications
Product Name Alternative
Mis5, P105MCM, MCG40308
UniProt
Q14566
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_005906.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-2457R-BF594 100 µL
TNFRSF14 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
Sign In for Pricing
View Details 
A3999-68M-PE 200 µL
ATP5O, NT (ATP Synthase Subunit O, Mitochondrial, Oligomycin Sensitivity Conferral Protein, OSCP, ATP5O) (PE) discontinued
Sign In for Pricing
View Details