Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGOH Peptide - middle region

MAGOH Peptide - middle region

Product Specifications

Product Name Alternative

MAGOH1, MAGOHA

UniProt

P61326

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002361.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MCJ Antibody
RC-15383-01 50 μL

Recombinant MCJ Antibody

Sign In for Pricing
View Details
Recombinant MCJ Antibody
RC-15383-02 100 µL

Recombinant MCJ Antibody

Sign In for Pricing
View Details
Recombinant MCJ Antibody
RC-15383-03 1 mL

Recombinant MCJ Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Brain
CS806248 5x 5 µm

Tissue FFPE Sections, Brain

Sign In for Pricing
View Details
LDL Receptor (LDLR) Mouse Monoclonal Antibody [Clone ID: OTI7C5]
CF812510 100 µg

LDL Receptor (LDLR) Mouse Monoclonal Antibody [Clone ID: OTI7C5]

Sign In for Pricing
View Details
Mgst3 (NM_025569) Mouse Tagged ORF Clone
MG201107 10 µg

Mgst3 (NM_025569) Mouse Tagged ORF Clone

Sign In for Pricing
View Details