Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGOH Peptide - middle region

MAGOH Peptide - middle region

Product Specifications

Product Name Alternative

MAGOH1, MAGOHA

UniProt

P61326

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002361.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Amino-2-chlorobenzeneacetic Acid
TRC-A603915-250MG 250 mg

4-Amino-2-chlorobenzeneacetic Acid

Sign In for Pricing
View Details
GNAT3 Polyclonal Antibody
E-AB-19920-01 20 µL

GNAT3 Polyclonal Antibody

Sign In for Pricing
View Details
GNAT3 Polyclonal Antibody
E-AB-19920-02 60 µL

GNAT3 Polyclonal Antibody

Sign In for Pricing
View Details
GNAT3 Polyclonal Antibody
E-AB-19920-03 120 µL

GNAT3 Polyclonal Antibody

Sign In for Pricing
View Details
GNAT3 Polyclonal Antibody
E-AB-19920-04 200 µL

GNAT3 Polyclonal Antibody

Sign In for Pricing
View Details
Biotin Conjugated Goat Affinity Purified Antibody to Human Immunoglobulins,
BAF-006-2 2 mL

Biotin Conjugated Goat Affinity Purified Antibody to Human Immunoglobulins,

Sign In for Pricing
View Details