Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKACA Peptide - C-terminal region

PRKACA Peptide - C-terminal region

Product Specifications

Product Name Alternative

PKACA, PPNAD4

UniProt

P17612

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001291278.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TNFSF9 Protein (His Tag)
PKSM041162-01 10 µg

Recombinant Mouse TNFSF9 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse TNFSF9 Protein (His Tag)
PKSM041162-02 50 µg

Recombinant Mouse TNFSF9 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant hCG beta Monoclonal Antibody
AN301544L-01 50 µL

Recombinant hCG beta Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant hCG beta Monoclonal Antibody
AN301544L-02 100 µL

Recombinant hCG beta Monoclonal Antibody

Sign In for Pricing
View Details
Human C21orf62 activation kit by CRISPRa
GA111161 1 Kit

Human C21orf62 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560107 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details