Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKACA Peptide - C-terminal region

PRKACA Peptide - C-terminal region

Product Specifications

Product Name Alternative

PKACA, PPNAD4

UniProt

P17612

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001291278.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Akr1c13 Mouse Gene Knockout Kit (CRISPR)
KN501088 1 Kit

Akr1c13 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
QK1 (QKI) (NM_006775) Human Over-expression Lysate
LC402025 20 µg

QK1 (QKI) (NM_006775) Human Over-expression Lysate

Sign In for Pricing
View Details
(2E)-3-(Phenyl-d5)-2-propenoic Acid
TRC-P336186-50MG 50 mg

(2E)-3-(Phenyl-d5)-2-propenoic Acid

Sign In for Pricing
View Details
CD16 (FCGR3A) (NM_000569) Human Over-expression Lysate
LC400194 20 µg

CD16 (FCGR3A) (NM_000569) Human Over-expression Lysate

Sign In for Pricing
View Details
HMG1 (HMGB1) Mouse Monoclonal Antibody [Clone ID: KS1]
AM26447AF-N 100 µg

HMG1 (HMGB1) Mouse Monoclonal Antibody [Clone ID: KS1]

Sign In for Pricing
View Details
Cholic Acid-d4
TRC-C432603-5MG 5 mg

Cholic Acid-d4

Sign In for Pricing
View Details