SEC24D Peptide - N-terminal region
SEC24D Peptide - N-terminal region
Product Specifications
Product Name Alternative
CLCRP2
UniProt
O94855
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001304995.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PPGPPPPGPHQFGQNGAHATGHPPQRFPGPPPVNNVASSHAPYQPSAQSS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1087350-01 0.05 mg (E-Coli)
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Phosphopentomutase (deoB)
Sign In for Pricing
View Details MBS1087350-02 0.05 mg (Yeast)
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Phosphopentomutase (deoB)
Sign In for Pricing
View Details MBS1087350-03 0.05 mg (Baculovirus)
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Phosphopentomutase (deoB)
Sign In for Pricing
View Details MBS1087350-04 0.2 mg (E-Coli)
Recombinant Buchnera aphidicola subsp. Acyrthosiphon pisum Phosphopentomutase (deoB)
Sign In for Pricing
View Details