What is the catalog number for SEC24D Peptide - N-terminal region?

The catalog number for SEC24D Peptide - N-terminal region is orb1998587.

What sizes are available for SEC24D Peptide - N-terminal region?

SEC24D Peptide - N-terminal region is available in the following size(s): 100 µg.

Is SEC24D Peptide - N-terminal region in stock?

SEC24D Peptide - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

SEC24D Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLCRP2

UniProt

O94855

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001304995.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPGPPPPGPHQFGQNGAHATGHPPQRFPGPPPVNNVASSHAPYQPSAQSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LA223-1NO 1 unit

S.S. Test Tube Racks made out of 20g

Sign In for Pricing

View Details

QH49997S 200 Tests

Human GMCL2 qPCR Primer Pair

Sign In for Pricing

View Details

A15007-100 100 mg

Atrasentan HCl 100mg

Sign In for Pricing

View Details

MBS1008443-01 0.02 mg (E-Coli)

Recombinant Salmonella agona Protein viaA (viaA)

Sign In for Pricing

View Details

MBS1008443-02 0.02 mg (Yeast)

Recombinant Salmonella agona Protein viaA (viaA)

Sign In for Pricing

View Details

MBS1008443-03 0.1 mg (E-Coli)

Recombinant Salmonella agona Protein viaA (viaA)

Sign In for Pricing

View Details