Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDL1 Peptide - middle region

SPDL1 Peptide - middle region

Product Specifications

Product Name Alternative

CCDC99

UniProt

Q96EA4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060255.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQALQQALDPNSKGNSLFAEVEDRRAAMERQLISMKVKYQSLKKQNVFNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZFP91 Antibody - N-terminal region : HRP (ARP36119_P050-HRP)
ARP36119_P050-HRP 100 µL

ZFP91 Antibody - N-terminal region : HRP (ARP36119_P050-HRP)

Sign In for Pricing
View Details
SLC12A1 (11O16) Rabbit Monoclonal Antibody
E28M0647 100 µL

SLC12A1 (11O16) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Silicon Nanopowder
26112-1 5 Gms

Silicon Nanopowder

Sign In for Pricing
View Details
Human HAUS1 Protein Lysate
MBS8412774-01 0.02 mg

Human HAUS1 Protein Lysate

Sign In for Pricing
View Details
Human HAUS1 Protein Lysate
MBS8412774-02 5x 0.02 mg

Human HAUS1 Protein Lysate

Sign In for Pricing
View Details
Lentiviral human FAM78A shRNA (UAS) - Lentiviral human FAM78A shRNA (UAS) (100)
GTR15163602 1 Vial

Lentiviral human FAM78A shRNA (UAS) - Lentiviral human FAM78A shRNA (UAS) (100)

Sign In for Pricing
View Details