Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDL1 Peptide - middle region

SPDL1 Peptide - middle region

Product Specifications

Product Name Alternative

CCDC99

UniProt

Q96EA4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_060255.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DQALQQALDPNSKGNSLFAEVEDRRAAMERQLISMKVKYQSLKKQNVFNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Anti-HA Influenza A (AThailand82022) & (AMassachusetts182022) Antibody, Human IgG1 (3B8) (MALS verified)
HA1-MY2169-100ug 100 µg

Monoclonal Anti-HA Influenza A (AThailand82022) & (AMassachusetts182022) Antibody, Human IgG1 (3B8) (MALS verified)

Sign In for Pricing
View Details
Human anti-Pertussiu Toxin, PT-Ab ELISA Kit
SL0233Hu-01 48 Tests

Human anti-Pertussiu Toxin, PT-Ab ELISA Kit

Sign In for Pricing
View Details
Human anti-Pertussiu Toxin, PT-Ab ELISA Kit
SL0233Hu-02 96 Tests

Human anti-Pertussiu Toxin, PT-Ab ELISA Kit

Sign In for Pricing
View Details
PFDN1 ELISA Kit (Human) (OKCD00882)
OKCD00882 96 Well

PFDN1 ELISA Kit (Human) (OKCD00882)

Sign In for Pricing
View Details
Mouse Hcrtr2 qPCR Primer Pair
QM73954S 200 Tests

Mouse Hcrtr2 qPCR Primer Pair

Sign In for Pricing
View Details
ADAM18 shRNA Plasmid (m)
sc-140853-SH 20 µg

ADAM18 shRNA Plasmid (m)

Sign In for Pricing
View Details