Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMDS Peptide - middle region

GMDS Peptide - middle region

Product Specifications

Product Name Alternative

GMD, SDR3E1

UniProt

O60547

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001240775.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mexazolam
TRC-M340600-25MG 25 mg

Mexazolam

Sign In for Pricing
View Details
PI3 Kinase p110 alpha Antibody
KC-3277-01 50 μL

PI3 Kinase p110 alpha Antibody

Sign In for Pricing
View Details
PI3 Kinase p110 alpha Antibody
KC-3277-02 100 µL

PI3 Kinase p110 alpha Antibody

Sign In for Pricing
View Details
PI3 Kinase p110 alpha Antibody
KC-3277-03 1 mL

PI3 Kinase p110 alpha Antibody

Sign In for Pricing
View Details
GRIM19 (NDUFA13) Human Gene Knockout Kit (CRISPR)
KN218988RB 1 Kit

GRIM19 (NDUFA13) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
USP30 Human Gene Knockout Kit (CRISPR)
KN202538 1 Kit

USP30 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details