Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GMDS Peptide - middle region

GMDS Peptide - middle region

Product Specifications

Product Name Alternative

GMD, SDR3E1

UniProt

O60547

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001240775.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometrium
CS707805 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
EB2 (MAPRE2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F3]
TA502961BM 100 µL

EB2 (MAPRE2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5F3]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB614371 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details
Copper Pyrithione
TRC-C685425-500MG 500 mg

Copper Pyrithione

Sign In for Pricing
View Details
COQ7 (NM_001190983) Human Over-expression Lysate
LY433767 100 µg

COQ7 (NM_001190983) Human Over-expression Lysate

Sign In for Pricing
View Details
Streptococcus agalactiae TaqMan PCR Lyophilized
TM30610L 100 Reactions

Streptococcus agalactiae TaqMan PCR Lyophilized

Sign In for Pricing
View Details