Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPY10 Peptide - C-terminal region

TSPY10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CT78, TSPY, TSPY1, TSPY3

UniProt

Q01534

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001071165.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3731), CF647 conjugate, 0.1mg/mL
BNC473731-500 1x 500 µL

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3731), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Microphthalmia Transcription Factor (MITF) (MITF/2987R), CF568 conjugate, 0.1mg/mL
BNC682987-500 1x 500 µL

Microphthalmia Transcription Factor (MITF) (MITF/2987R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse IL-18 Recombinant Rabbit monoclonal Antibody
HA723416 100 µL

Mouse IL-18 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
OGG1 (C-term) Rabbit Polyclonal Antibody
AP17606PU-N 400 µL

OGG1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Protein Kinase D2 (PRKD2) (NM_001079880) Human Over-expression Lysate
LC421574 20 µg

Protein Kinase D2 (PRKD2) (NM_001079880) Human Over-expression Lysate

Sign In for Pricing
View Details
Human WDPCP activation kit by CRISPRa
GA109524 1 Kit

Human WDPCP activation kit by CRISPRa

Sign In for Pricing
View Details