Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSPY10 Peptide - C-terminal region

TSPY10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CT78, TSPY, TSPY1, TSPY3

UniProt

Q01534

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001071165.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KRTAP12-2 activation kit by CRISPRa
GA117730 1 Kit

Human KRTAP12-2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Aorta
CS807956 5x 5 µm

Tissue FFPE Sections, Aorta

Sign In for Pricing
View Details
Human TADA3L (TADA3) activation kit by CRISPRa
GA107149 1 Kit

Human TADA3L (TADA3) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS707547 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
INPP5F (NM_014937) Human Recombinant Protein
TP311091L 1 mg

INPP5F (NM_014937) Human Recombinant Protein

Sign In for Pricing
View Details
Cytokeratin 2 (KRT76) Human Gene Knockout Kit (CRISPR)
KN422015 1 Kit

Cytokeratin 2 (KRT76) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details