NUS1 Peptide - middle region
NUS1 Peptide - middle region
Product Specifications
Product Name Alternative
NgBR, C6orf68, TANGO14, MGC:7199
UniProt
Q96E22
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_612468.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YDHQGIFKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
CPB-1201RH 100 ul
Rabbit Anti-Human FAM129A (aa 160-175) Polyclonal Antibody
Sign In for Pricing
View Details MBS2095234-01 0.1 mL
Biotin-Linked Polyclonal Antibody to Slit Homolog 3 (Slit3)
Sign In for Pricing
View Details MBS2095234-02 0.2 mL
Biotin-Linked Polyclonal Antibody to Slit Homolog 3 (Slit3)
Sign In for Pricing
View Details MBS2095234-03 0.5 mL
Biotin-Linked Polyclonal Antibody to Slit Homolog 3 (Slit3)
Sign In for Pricing
View Details MBS2095234-04 1 mL
Biotin-Linked Polyclonal Antibody to Slit Homolog 3 (Slit3)
Sign In for Pricing
View Details