What is the catalog number for NUS1 Peptide - middle region?

The catalog number for NUS1 Peptide - middle region is orb1998465.

What sizes are available for NUS1 Peptide - middle region?

NUS1 Peptide - middle region is available in the following size(s): 100 µg.

Is NUS1 Peptide - middle region in stock?

NUS1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

NUS1 Peptide - middle region

Product Specifications

Product Name Alternative

NgBR, C6orf68, TANGO14, MGC:7199

UniProt

Q96E22

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_612468.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YDHQGIFKRNNSRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NBP3-08244DL594 100 µL

Rabbit Monoclonal CD43/Sialophorin Antibody (SPN/2049R) [DyLight 594]

Sign In for Pricing

View Details

A29301-100UG 100 µg

MZF1 Antibody

Sign In for Pricing

View Details

K0193403 1.0 µg DNA

BRCA1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing

View Details

VAng-Ly2423-1mgEcoli 1 mg (E. coli)

Recombinant Campylobacter Jejuni rpsS Protein (aa 1-93) (strain 81116 / NCTC 11828)

Sign In for Pricing

View Details

sc-475413 100 mg

6-Bromochromone-3-carboxylic acid

Sign In for Pricing

View Details

MBS6399582-01 0.1 mL

ANXA3 (Annexin A3, Annexin-3, Annexin III, Lipocortin III, Placental Anticoagulant Protein III, PAP-III, 35-alpha Calcimedin, Inositol 1,2-cyclic Phosphate 2-phosphohydrolase, ANX3) (Biotin)

Sign In for Pricing

View Details