Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS2 Peptide - middle region

SARS2 Peptide - middle region

Product Specifications

Product Name Alternative

SYS, SARS, SERS, SARSM, SerRS, SerRSmt, mtSerRS

UniProt

Q9NP81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139373.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLLRRGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT2 (NM_001199302) Human Tagged ORF Clone
RC232950 10 µg

CNOT2 (NM_001199302) Human Tagged ORF Clone

Sign In for Pricing
View Details
SRPK2 (SRSF Protein Kinase 2, SFRSK2, SFRS Protein Kinase 2, Serine/arginine-rich protein-specific kinase 2)
365172 200 µL

SRPK2 (SRSF Protein Kinase 2, SFRSK2, SFRS Protein Kinase 2, Serine/arginine-rich protein-specific kinase 2)

Sign In for Pricing
View Details
Quick Step Bovine Rotavirus (RV) elisa Kit
QS0087Bo-01 48 Tests

Quick Step Bovine Rotavirus (RV) elisa Kit

Sign In for Pricing
View Details
Quick Step Bovine Rotavirus (RV) elisa Kit
QS0087Bo-02 96 Tests

Quick Step Bovine Rotavirus (RV) elisa Kit

Sign In for Pricing
View Details
GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (APC)
MBS6419721-01 0.1 mL

GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (APC)

Sign In for Pricing
View Details
GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (APC)
MBS6419721-02 5x 0.1 mL

GUCY1B3 (Guanylate Cyclase 1 Beta 3, GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B1, GC-S-beta-1) (APC)

Sign In for Pricing
View Details