Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACE2 Peptide - C-terminal region

ACE2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACEH

UniProt

Q9BYF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_068576.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABRR1 Human Gene Knockout Kit (CRISPR)
KN417506 1 Kit

GABRR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ku80 (Ab-714) Antibody
8B0450-AAT 50 µg

Ku80 (Ab-714) Antibody

Sign In for Pricing
View Details
GPCR MRGX2 (MRGPRX2) (C-term) Rabbit Polyclonal Antibody
AP52746PU-N 400 µL

GPCR MRGX2 (MRGPRX2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (TS1), Biotin conjugate, 0.1mg/mL
BNCB0627-100 1x 100 µL

Cytokeratin 8 (TS1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS637439 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
2-Chloroethyl Chloroformate
TRC-C367245-1G 1 g

2-Chloroethyl Chloroformate

Sign In for Pricing
View Details