Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACE2 Peptide - C-terminal region

ACE2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACEH

UniProt

Q9BYF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_068576.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENPYAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELP4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B2]
TA809145AM 100 µL

ELP4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B2]

Sign In for Pricing
View Details
Tissue FFPE Sections, Artery: peripheral
CS800273 5x 5 µm

Tissue FFPE Sections, Artery: peripheral

Sign In for Pricing
View Details
Recombinant Keratin 16 Monoclonal Antibody
AN301575L-01 50 µL

Recombinant Keratin 16 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Keratin 16 Monoclonal Antibody
AN301575L-02 100 µL

Recombinant Keratin 16 Monoclonal Antibody

Sign In for Pricing
View Details
CCNB1 Rabbit Monoclonal Antibody [Clone ID: 24GB4305]
TA424694 100 µL

CCNB1 Rabbit Monoclonal Antibody [Clone ID: 24GB4305]

Sign In for Pricing
View Details
CINP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8E4]
TA812290BM 100 µL

CINP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8E4]

Sign In for Pricing
View Details