Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ING2 Peptide - middle region

ING2 Peptide - middle region

Product Specifications

Product Name Alternative

ING1L, p33ING2

UniProt

Q9H160

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278888.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MELHSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSESRDLCHMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary: bilateral
CB527218 1 Block

Frozen Tissue Blocks, Ovary: bilateral

Sign In for Pricing
View Details
CSN7b (COPS7B) (NM_001282952) Human Tagged ORF Clone
RG236141 10 µg

CSN7b (COPS7B) (NM_001282952) Human Tagged ORF Clone

Sign In for Pricing
View Details
RASSF8 (N-term) Rabbit Polyclonal Antibody
AP53593PU-N 400 µL

RASSF8 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Salicylanilide
TRC-S088095-250MG 250 mg

Salicylanilide

Sign In for Pricing
View Details
Recombinant LMNB2 Antibody
RC-4622-01 50 μL

Recombinant LMNB2 Antibody

Sign In for Pricing
View Details
Recombinant LMNB2 Antibody
RC-4622-02 100 µL

Recombinant LMNB2 Antibody

Sign In for Pricing
View Details