Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ING2 Peptide - middle region

ING2 Peptide - middle region

Product Specifications

Product Name Alternative

ING1L, p33ING2

UniProt

Q9H160

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001278888.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MELHSQCFQDPAESERASDKAKMDSSQPERSSRRPRRQRTSESRDLCHMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCA3 Antibody
8C12174-AAT 50 µg

CDCA3 Antibody

Sign In for Pricing
View Details
Carboxylated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
MGB04F2-COOH 10x 96 Well Plates

Carboxylated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2511), CF405S conjugate, 0.1mg/mL
BNC042511-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2511), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RASGRP 4 (RASGRP4) activation kit by CRISPRa
GA114542 1 Kit

Human RASGRP 4 (RASGRP4) activation kit by CRISPRa

Sign In for Pricing
View Details
CK-7 Polyclonal Antibody
E-AB-70092-01 60 µL

CK-7 Polyclonal Antibody

Sign In for Pricing
View Details
CK-7 Polyclonal Antibody
E-AB-70092-02 120 µL

CK-7 Polyclonal Antibody

Sign In for Pricing
View Details