Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHC2 Peptide - middle region

PHC2 Peptide - middle region

Product Specifications

Product Name Alternative

PH2, EDR2, HPH2

UniProt

Q8IXK0

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004418.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSSKHLQPQFVIQQQPQPQQQQPPPQQSRPVLQAEPHPQLASVSPSVALQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IZUMO1 Human Pre-designed siRNA Set A
HY-RS07004 1 Set

IZUMO1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Bovine Calcium-activated chloride channel regulator family member 3 (CLCA3) ELISA Kit
MBS7245558-01 48 Well

Bovine Calcium-activated chloride channel regulator family member 3 (CLCA3) ELISA Kit

Sign In for Pricing
View Details
Bovine Calcium-activated chloride channel regulator family member 3 (CLCA3) ELISA Kit
MBS7245558-02 96 Well

Bovine Calcium-activated chloride channel regulator family member 3 (CLCA3) ELISA Kit

Sign In for Pricing
View Details
Bovine Calcium-activated chloride channel regulator family member 3 (CLCA3) ELISA Kit
MBS7245558-03 5x 96 Well

Bovine Calcium-activated chloride channel regulator family member 3 (CLCA3) ELISA Kit

Sign In for Pricing
View Details
Bovine Calcium-activated chloride channel regulator family member 3 (CLCA3) ELISA Kit
MBS7245558-04 10x 96 Well

Bovine Calcium-activated chloride channel regulator family member 3 (CLCA3) ELISA Kit

Sign In for Pricing
View Details
Anti-Adiponectin Receptor 1/ADIPOR1 Antibody Picoband® Fluoro488 Conjugated
PB9418-Fluoro488 100 µg/Vial

Anti-Adiponectin Receptor 1/ADIPOR1 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details