PHC2 Peptide - middle region
PHC2 Peptide - middle region
Product Specifications
Product Name Alternative
PH2, EDR2, HPH2
UniProt
Q8IXK0
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_004418.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PSSKHLQPQFVIQQQPQPQQQQPPPQQSRPVLQAEPHPQLASVSPSVALQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1117421-01 0.02 mg (E-Coli)
Recombinant Rhodococcus opacus D-inositol 3-phosphate glycosyltransferase (mshA)
Sign In for Pricing
View Details MBS1117421-02 0.02 mg (Yeast)
Recombinant Rhodococcus opacus D-inositol 3-phosphate glycosyltransferase (mshA)
Sign In for Pricing
View Details MBS1117421-03 0.1 mg (E-Coli)
Recombinant Rhodococcus opacus D-inositol 3-phosphate glycosyltransferase (mshA)
Sign In for Pricing
View Details MBS1117421-04 0.1 mg (Yeast)
Recombinant Rhodococcus opacus D-inositol 3-phosphate glycosyltransferase (mshA)
Sign In for Pricing
View Details MBS1117421-05 0.02 mg (Baculovirus)
Recombinant Rhodococcus opacus D-inositol 3-phosphate glycosyltransferase (mshA)
Sign In for Pricing
View Details MBS1117421-06 0.02 mg (Mammalian-Cell)
Recombinant Rhodococcus opacus D-inositol 3-phosphate glycosyltransferase (mshA)
Sign In for Pricing
View Details