Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASA2 Peptide - middle region

RASA2 Peptide - middle region

Product Specifications

Product Name Alternative

GAP1M

UniProt

Q15283

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001290174.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRDNGNKSSKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLCA1 Adenovirus (Rat)
16240056 1.0 mL

CLCA1 Adenovirus (Rat)

Sign In for Pricing
View Details
Anti-p73/TP73 Antibody Picoband®
PB9235 100 µg/Vial

Anti-p73/TP73 Antibody Picoband®

Sign In for Pricing
View Details
Mouse Polyclonal ZSWIM2 Antibody
H00151112-B01P 0.05 mg

Mouse Polyclonal ZSWIM2 Antibody

Sign In for Pricing
View Details
ADAM23, CT (ADAM23, MDC3, Disintegrin and metalloproteinase domain-containing protein 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3) (FITC) discontinued
031605-FITC 200 µL

ADAM23, CT (ADAM23, MDC3, Disintegrin and metalloproteinase domain-containing protein 23, Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3) (FITC) discontinued

Sign In for Pricing
View Details
Dok-6 (263-275)
E-PP-1047-01 10 mg

Dok-6 (263-275)

Sign In for Pricing
View Details
Dok-6 (263-275)
E-PP-1047-02 100 mg

Dok-6 (263-275)

Sign In for Pricing
View Details