Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASA2 Peptide - middle region

RASA2 Peptide - middle region

Product Specifications

Product Name Alternative

GAP1M

UniProt

Q15283

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001290174.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRDNGNKSSKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASF1A Peptide
orb1234398 0.1 mg

ASF1A Peptide

Sign In for Pricing
View Details
Hsa-miR-4685-5p miRNA Antagomir
orb1914805-01 10 nmol

Hsa-miR-4685-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-4685-5p miRNA Antagomir
orb1914805-02 20 nmol

Hsa-miR-4685-5p miRNA Antagomir

Sign In for Pricing
View Details
CHD3 Antibody
OACD02502-1ML 1 mL

CHD3 Antibody

Sign In for Pricing
View Details
KMT2E Knockout Hela Polyclonal Cells
ARG37470 1 Million

KMT2E Knockout Hela Polyclonal Cells

Sign In for Pricing
View Details
MIR26A1 Human qPCR Primer Pair (MI0000083)
HP300272 200 Reactions

MIR26A1 Human qPCR Primer Pair (MI0000083)

Sign In for Pricing
View Details