Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYOZ1 Peptide - middle region

MYOZ1 Peptide - middle region

Product Specifications

Product Name Alternative

CS-2, FATZ, MYOZ

UniProt

Q9NP98

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_067068.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ALDH3A1 Monoclonal Antibody
AN301430L-01 50 µL

Recombinant ALDH3A1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant ALDH3A1 Monoclonal Antibody
AN301430L-02 100 µL

Recombinant ALDH3A1 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Tuba8 activation kit by CRISPRa
GA205603 1 Kit

Mouse Tuba8 activation kit by CRISPRa

Sign In for Pricing
View Details
CD45RB (PD7/26), CF488A conjugate, 0.1mg/mL
BNC880472-100 1x 100 µL

CD45RB (PD7/26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details