Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAK2 Peptide - middle region

PAK2 Peptide - middle region

Product Specifications

Product Name Alternative

PAK65, PAKgamma

UniProt

Q13177

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002568.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LEMD1 (NM_001001552) Human Over-expression Lysate
LC424377 20 µg

LEMD1 (NM_001001552) Human Over-expression Lysate

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF405S conjugate, 0.1mg/mL
BNC040902-100 1x 100 µL

Nucleolin (NCL/902), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Anti-Human CD45 Antibody[HI30]
E-AB-F1137E-01 20 Tests

APC Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
APC Anti-Human CD45 Antibody[HI30]
E-AB-F1137E-02 100 Tests

APC Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
APC Anti-Human CD45 Antibody[HI30]
E-AB-F1137E-03 2x 100 Tests

APC Anti-Human CD45 Antibody[HI30]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD2 Antibody[RPA-2.10]
E-AB-F1375J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD2 Antibody[RPA-2.10]

Sign In for Pricing
View Details