Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAK2 Peptide - middle region

PAK2 Peptide - middle region

Product Specifications

Product Name Alternative

PAK65, PAKgamma

UniProt

Q13177

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002568.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD40L/TNFSF5 Protein (His Tag)
PKSH031976-01 100 µg

Recombinant Human CD40L/TNFSF5 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CD40L/TNFSF5 Protein (His Tag)
PKSH031976-02 1 mg

Recombinant Human CD40L/TNFSF5 Protein (His Tag)

Sign In for Pricing
View Details
SpectraTube™ Rainbow Capped Centrifuge Tubes
C2750 500 Units/Case

SpectraTube™ Rainbow Capped Centrifuge Tubes

Sign In for Pricing
View Details
4-((but-3-en-1-yloxy)carbonyl)benzoic acid
TRC-B583890-50MG 50 mg

4-((but-3-en-1-yloxy)carbonyl)benzoic acid

Sign In for Pricing
View Details
VAMP3 (Center) Rabbit Polyclonal Antibody
AP54499PU-N 400 µL

VAMP3 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ZNF25 Human Gene Knockout Kit (CRISPR)
KN422964 1 Kit

ZNF25 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details