Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD3EAP Peptide - middle region

CD3EAP Peptide - middle region

Product Specifications

Product Name Alternative

ASE1, CAST, ASE-1, PAF49

UniProt

O15446

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001284519.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLKEPEAAGPVGTEPTVETLEPLGVLFPSTTKKRKKPKGKETFEPEDKTV

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf105 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0210405 3x 1.0 µg

C1orf105 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ARHGEF40 (Rho Guanine Nucleotide Exchange Factor 40)
475573 100 µL

ARHGEF40 (Rho Guanine Nucleotide Exchange Factor 40)

Sign In for Pricing
View Details
Polyclonal CD1D Antibody
APR03369G 0.05ml

Polyclonal CD1D Antibody

Sign In for Pricing
View Details
B3GALT6 Antibody
orb1264357 400 μl

B3GALT6 Antibody

Sign In for Pricing
View Details
KCHIP1 Rabbit Polyclonal Antibody
orb1289837-01 30 µL

KCHIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCHIP1 Rabbit Polyclonal Antibody
orb1289837-02 50 μL

KCHIP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details